PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr034417.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 231aa    MW: 25986.4 Da    PI: 9.0576
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr034417.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.31.3e-48141381128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrF+Ptdeelv +yL+ kv + +l++ ++i+e++++ ++PwdLp    ++e+e yfFs++++ky++g+r+nr+t sgyWkatg dk+++s+ ++
  Pbr034417.1  14 LPPGFRFQPTDEELVFQYLRCKVFSCPLPA-SIIPEINVCMYDPWDLP---GNSEQERYFFSNKESKYRNGNRANRVTGSGYWKATGADKKIVSSrRN 107
                  79****************************.89***************...446889***********************************998677 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + vg kktLvfy+g++p+ +ktdWvmhey l
  Pbr034417.1 108 HIVGKKKTLVFYRGKSPHVSKTDWVMHEYCL 138
                  78***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-578168IPR003441NAC domain
PROSITE profilePS5100554.12914168IPR003441NAC domain
PfamPF023654.6E-2515138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MDKFKFVGNG MIRLPPGFRF QPTDEELVFQ YLRCKVFSCP LPASIIPEIN VCMYDPWDLP  60
GNSEQERYFF SNKESKYRNG NRANRVTGSG YWKATGADKK IVSSRRNHIV GKKKTLVFYR  120
GKSPHVSKTD WVMHEYCLVN TETTASIHTT ENALTPKGNW VLCRVFSKKR SGKIDEEIVV  180
NYNSIEVNNN ANPASSSSSC SSSTGITEVT SPSKECGEEI SSCRKFDHVN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-451217315170NO APICAL MERISTEM PROTEIN
1ut4_B1e-451217315170NO APICAL MERISTEM PROTEIN
1ut7_A1e-451217315170NO APICAL MERISTEM PROTEIN
1ut7_B1e-451217315170NO APICAL MERISTEM PROTEIN
3swm_A1e-451217318173NAC domain-containing protein 19
3swm_B1e-451217318173NAC domain-containing protein 19
3swm_C1e-451217318173NAC domain-containing protein 19
3swm_D1e-451217318173NAC domain-containing protein 19
3swp_A1e-451217318173NAC domain-containing protein 19
3swp_B1e-451217318173NAC domain-containing protein 19
3swp_C1e-451217318173NAC domain-containing protein 19
3swp_D1e-451217318173NAC domain-containing protein 19
4dul_A1e-451217315170NAC domain-containing protein 19
4dul_B1e-451217315170NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342208.11e-173PREDICTED: NAC transcription factor 25-like
RefseqXP_009342214.11e-173PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY931e-80NAC83_ARATH; NAC domain-containing protein 83
TrEMBLM5WSR91e-124M5WSR9_PRUPE; Uncharacterized protein
STRINGVIT_01s0146g00280.t012e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.13e-81NAC domain containing protein 83